
VIP10 – 10mg
$130.00
- Purity
- ≥99% COA-verified
- CAS Number
- internal:vip10
- Size
- 10mg
Volume Pricing — Auto-Applied
Discount applied automatically at checkout
Size: 10mg
SKU: YPB.281
Category: Experimental Compounds
Research Use Only
This product is sold strictly for in vitro research and laboratory use only, consistent with 21 CFR § 809.10(c)(2)(i). It is not a drug, dietary supplement, food, cosmetic, or medical device. It has not been evaluated or approved by the FDA or any comparable foreign authority for any therapeutic, diagnostic, prophylactic, veterinary, or cosmetic use, and it is not intended for human or animal consumption, application, ingestion, injection, inhalation, or any in vivo use.
Buyer eligibility. By purchasing, you represent that you are at least 21, a qualified researcher or research-affiliated professional, that your purchase is for a lawful in vitro research purpose, and that purchase and possession are lawful in your jurisdiction.
No protocols or guidance. Any product information on this page is provided for bibliographic and laboratory-reference purposes only. PeptaLux does not provide research protocols, dosing guidance, administration instructions, or product recommendations.
Terms of sale. Sold AS IS, AS AVAILABLE, with all warranties disclaimed to the maximum extent permitted by law. Buyer assumes all risk and indemnifies PeptaLux as set out in the Terms and Conditions, Refund Policy, Shipping Policy, and Privacy Policy, which you accept by purchasing.
⚡ One-time researcher verification at first add — takes 20 seconds.
Batch dated: Apr 14, 2026
Description
VIP (vasoactive intestinal peptide) is a 28-amino-acid neuropeptide of the secretin/glucagon superfamily; "VIP10" is a non-standardized research designation that may refer to an N- or C-terminal fragment of the parent molecule, and its precise identity should be confirmed against supplier-issued certificates of analysis. In vitro and rodent-model research literature on parent VIP has characterized its interaction with the VPAC1 and VPAC2 receptors and downstream cAMP/PKA signaling pathways (Harmar et al., Pharmacol. Rev., 1998). Rodent-model investigations have examined its association with neuroimmune signaling cascades and circadian-rhythm pathway modulation in suprachiasmatic nucleus tissue (Vaudry et al., Pharmacol. Rev., 2000). Findings in in vitro / animal studies do not necessarily translate to other systems.
Operator review needed — VIP10 designation is non-standardized in primary literature. Confirm with YPB whether the product is an N-terminal or C-terminal VIP fragment, and obtain supplier certificate of analysis for definitive sequence/mass data. Site editor should set custom field cas_number=internal:vip10 on this product to enable lookup.
VIP-10 is a fragment of Vasoactive Intestinal Peptide (VIP), a 28-amino acid neuropeptide.
Specifications
- Molecular formula
- [Data unavailable from authoritative sources]
- Molecular weight
- [Data unavailable from authoritative sources]
- Sequence
- VIP10 designation non-standardized in primary literature; full-length parent VIP-28: HSDAVFTDNYTRLRKQMAVKKYLNSILN-NH2
- Appearance
- White lyophilized powder
- Solubility
- Soluble in sterile water
- Storage
- -20°C, protected from light, sealed container
Shipping & Returns
Shipping
PeptaLux ships exclusively from US-based fulfillment. US orders only. Standard shipping: 3-5 business days. Priority shipping: 1-2 business days. Free shipping on research orders over $250.
Storage & Handling
Storage requirements vary by compound. See “Storage” under Specifications above for this product’s specifics. Customers are responsible for proper storage on receipt.
Returns
All sales are final. Limited exceptions for confirmed non-delivery and PeptaLux-error situations. See our full Refund Policy for the operative terms. View Refund Policy



