Free shipping on research orders over $250Free shipping over $250 →
PeptaLux
Home Shop Tesamorelin – 20mg
Peptides (RUO)

Tesamorelin – 20mg

$149.00

Purity
≥99% COA-verified
CAS Number
internal:tesamorelin
Size
20mg

Volume Pricing — Auto-Applied

3–5 units $134.10 each (save 10%)
6+ units $126.65 each (save 15%)

Discount applied automatically at checkout

Size: 20mg
SKU: YPB.288
Category: Peptides (RUO)

Research Use Only

This product is sold strictly for in vitro research and laboratory use only, consistent with 21 CFR § 809.10(c)(2)(i). It is not a drug, dietary supplement, food, cosmetic, or medical device. It has not been evaluated or approved by the FDA or any comparable foreign authority for any therapeutic, diagnostic, prophylactic, veterinary, or cosmetic use, and it is not intended for human or animal consumption, application, ingestion, injection, inhalation, or any in vivo use.

Buyer eligibility. By purchasing, you represent that you are at least 21, a qualified researcher or research-affiliated professional, that your purchase is for a lawful in vitro research purpose, and that purchase and possession are lawful in your jurisdiction.

No protocols or guidance. Any product information on this page is provided for bibliographic and laboratory-reference purposes only. PeptaLux does not provide research protocols, dosing guidance, administration instructions, or product recommendations.

Terms of sale. Sold AS IS, AS AVAILABLE, with all warranties disclaimed to the maximum extent permitted by law. Buyer assumes all risk and indemnifies PeptaLux as set out in the Terms and Conditions, Refund Policy, Shipping Policy, and Privacy Policy, which you accept by purchasing.

⚡ One-time researcher verification at first add — takes 20 seconds.

View Certificate of Analysis

Batch dated: Feb 27, 2026

Third-Party TestedShips from USADiscreet & Secure Shipping
Description

Tesamorelin is a synthetic analog of human growth hormone-releasing hormone (GHRH 1-44) bearing an N-terminal trans-3-hexenoyl modification that confers protection against dipeptidyl peptidase-IV (DPP-IV) proteolysis. In vitro and rodent-model research literature has characterized its interaction with the GHRH receptor (GHRHR) on anterior pituitary somatotrophs and downstream cAMP/PKA signaling pathways with enhanced plasma stability relative to native GHRH (Ferdinandi et al., Basic Clin. Pharmacol. Toxicol., 2007). Rodent-model pituitary investigations have examined its association with somatotroph-axis pulsatile signaling pathway dynamics (Stanley et al., Mol. Cell. Endocrinol., 2014). Findings in in vitro / animal studies do not necessarily translate to other systems.

CAS 901758-09-6 is shared with GDF-8 (Myostatin) in some indices. Site editor should set custom field cas_number=internal:tesamorelin on this product to enable lookup, or verify which compound is at CAS 901758-09-6.

Tesamorelin is a synthetic GHRH analog with a trans-3-hexenoic acid modification. High-quantity format.

Specifications
Molecular formula
C221H366N72O67S
Molecular weight
5135.85 g/mol
Sequence
(3-hexenoyl)-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL-NH2 (44 amino acids, N-acylated, C-amidated)
Appearance
White lyophilized powder
Solubility
Soluble in sterile water
Storage
-20°C, protected from light, sealed container
Sources & Citations
Shipping & Returns

Shipping

PeptaLux ships exclusively from US-based fulfillment. US orders only. Standard shipping: 3-5 business days. Priority shipping: 1-2 business days. Free shipping on research orders over $250.

Storage & Handling

Storage requirements vary by compound. See “Storage” under Specifications above for this product’s specifics. Customers are responsible for proper storage on receipt.

Returns

All sales are final. Limited exceptions for confirmed non-delivery and PeptaLux-error situations. See our full Refund Policy for the operative terms. View Refund Policy

More Peptides (RUO) Compounds →

0
  • Please confirm the research-use gate before proceeding to checkout.
0
Your Cart
Your cart is emptyReturn to Shop