Thymosin Beta 4 (TB500) – 10mg
Pricing available after verification
Volume Pricing — Auto-Applied
Discount applied automatically at checkout
Size: 10mg
SKU: YPB.215
Category: Peptides (RUO)
Research Use Only
This product is sold strictly for in vitro research and laboratory use only, consistent with 21 CFR § 809.10(c)(2)(i). It is not a drug, dietary supplement, food, cosmetic, or medical device. It has not been evaluated or approved by the FDA or any comparable foreign authority for any therapeutic, diagnostic, prophylactic, veterinary, or cosmetic use, and it is not intended for human or animal consumption, application, ingestion, injection, inhalation, or any in vivo use.
Buyer eligibility. By purchasing, you represent that you are at least 21, a qualified researcher or research-affiliated professional, that your purchase is for a lawful in vitro research purpose, and that purchase and possession are lawful in your jurisdiction.
No protocols or guidance. Any product information on this page is provided for bibliographic and laboratory-reference purposes only. PeptaLux does not provide research protocols, dosing guidance, administration instructions, or product recommendations.
Terms of sale. Sold AS IS, AS AVAILABLE, with all warranties disclaimed to the maximum extent permitted by law. Buyer assumes all risk and indemnifies PeptaLux as set out in the Terms and Conditions, Refund Policy, Shipping Policy, and Privacy Policy, which you accept by purchasing.
Description
Thymosin β4 is a 43-amino-acid G-actin sequestering peptide that binds monomeric actin via its conserved LKKTETQ motif and modulates actin cytoskeletal dynamics. In vitro and rodent-model research has characterized its interaction with actin polymerization, endothelial cell migration, and the Ac-SDKP cleavage product (Crockford et al., Ann. N.Y. Acad. Sci., 2010). Murine and porcine in vivo studies have examined its association with cardiac progenitor cell migration pathways and PINCH-ILK-Akt signaling (Bock-Marquette et al., Nature, 2004). Findings in in vitro / animal studies do not necessarily translate to other systems.
TB-500 is a synthetic version of the naturally occurring 43-amino acid peptide thymosin beta-4.
Specifications
- Molecular formula
- C212H350N56O78S (full length Tβ4)
- Molecular weight
- 4963.44 g/mol (full length); TB-500 active fragment LKKTETQ ~889 g/mol
- Sequence
- SDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES (43 amino acids, full Tβ4)
- Appearance
- White to off-white lyophilized powder
- Solubility
- Soluble in sterile water
- Storage
- -20°C, protected from light, sealed container
Sources & Citations
Shipping & Returns
Shipping
PeptaLux ships exclusively from US-based fulfillment. US orders only. Standard shipping: 3-5 business days. Priority shipping: 1-2 business days. Free shipping on research orders over $250.
Storage & Handling
Storage requirements vary by compound. See “Storage” under Specifications above for this product’s specifics. Customers are responsible for proper storage on receipt.
Returns
All sales are final. Limited exceptions for confirmed non-delivery and PeptaLux-error situations. See our full Refund Policy for the operative terms. View Refund Policy
