Free shipping on research orders over $250Free shipping over $250 →
PeptaLux
Home Shop Cagrilintide – 10mg
Small Molecules (RUO)

Cagrilintide – 10mg

$155.00

Purity
≥99% COA-verified
CAS Number
1415456-99-3
Size
10mg

Volume Pricing — Auto-Applied

3–5 units $139.50 each (save 10%)
6+ units $131.75 each (save 15%)

Discount applied automatically at checkout

Size: 10mg
SKU: YPB.241
Category: Small Molecules (RUO)

Research Use Only

This product is sold strictly for in vitro research and laboratory use only, consistent with 21 CFR § 809.10(c)(2)(i). It is not a drug, dietary supplement, food, cosmetic, or medical device. It has not been evaluated or approved by the FDA or any comparable foreign authority for any therapeutic, diagnostic, prophylactic, veterinary, or cosmetic use, and it is not intended for human or animal consumption, application, ingestion, injection, inhalation, or any in vivo use.

Buyer eligibility. By purchasing, you represent that you are at least 21, a qualified researcher or research-affiliated professional, that your purchase is for a lawful in vitro research purpose, and that purchase and possession are lawful in your jurisdiction.

No protocols or guidance. Any product information on this page is provided for bibliographic and laboratory-reference purposes only. PeptaLux does not provide research protocols, dosing guidance, administration instructions, or product recommendations.

Terms of sale. Sold AS IS, AS AVAILABLE, with all warranties disclaimed to the maximum extent permitted by law. Buyer assumes all risk and indemnifies PeptaLux as set out in the Terms and Conditions, Refund Policy, Shipping Policy, and Privacy Policy, which you accept by purchasing.

⚡ One-time researcher verification at first add — takes 20 seconds.

Third-Party TestedShips from USADiscreet & Secure Shipping
Description

Cagrilintide is a synthetic long-acting analog of human amylin, engineered with substitutions conferring physical stability at neutral pH and a γ-glutamic acid C20 fatty diacid side chain supporting albumin binding. In vitro and rodent-model research literature has characterized its interaction with the amylin receptor complex (calcitonin receptor + RAMP1/2/3) and the calcitonin receptor and downstream cAMP signaling pathway activation in CNS and pancreatic tissue (Kruse et al., J. Med. Chem., 2021). Murine model hypothalamic and adipose-tissue investigations have examined its association with amylin-axis satiety-pathway signaling cascades (Larsen et al., Diabetes Obes. Metab., 2021). Findings in in vitro / animal studies do not necessarily translate to other systems.

Cagrilintide is a long-acting acylated amylin analog.

Specifications
Molecular formula
[Data unavailable from authoritative sources]
Molecular weight
~3800 g/mol (approximate; lipidated amylin analog)
Sequence
KCNTATCATQRLANFLVRSSNNLGAILSPTNVGSNTY-NH2 (37 residues, modified; γGlu-C20 fatty acid at Lys; intramolecular disulfide)
Appearance
White lyophilized powder
Solubility
Soluble in sterile water
Storage
-20°C, protected from light, sealed container
Sources & Citations
Shipping & Returns

Shipping

PeptaLux ships exclusively from US-based fulfillment. US orders only. Standard shipping: 3-5 business days. Priority shipping: 1-2 business days. Free shipping on research orders over $250.

Storage & Handling

Storage requirements vary by compound. See “Storage” under Specifications above for this product’s specifics. Customers are responsible for proper storage on receipt.

Returns

All sales are final. Limited exceptions for confirmed non-delivery and PeptaLux-error situations. See our full Refund Policy for the operative terms. View Refund Policy

More Small Molecules (RUO) Compounds →

0
  • Please confirm the research-use gate before proceeding to checkout.
0
Your Cart
Your cart is emptyReturn to Shop